SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463763 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463763
Domain Number 1 Region: 4-80
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.14e-20
Family Carboxypeptidase regulatory domain 0.0000281
Further Details:      
 
Weak hits

Sequence:  ENSP00000463763
Domain Number - Region: 138-169
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0058
Family Pancreatic carboxypeptidases 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463763   Gene: ENSG00000108582   Transcript: ENST00000584221
Sequence length 184
Comment pep:putative chromosome:GRCh38:17:30443802:30466423:1 gene:ENSG00000108582 transcript:ENST00000584221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHQGVRGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTYKITASARGYNP
VTKNVTVKSEGAIQVNFTLVRSSTDSNNESKKGKGASSSTNDASDPTTKEFETLIKDLSA
ENGLESLMLRSSSNLALALYRYHSYKDLSEFLRGLVMNYPHITNLTNLGPKNLLLSSQIV
FYIH
Download sequence
Identical sequences J3QQJ4
ENSP00000463763 ENSP00000463763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]