SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463934 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463934
Domain Number 1 Region: 103-178
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000000000141
Family N-terminal domain of adrenodoxin reductase-like 0.0000547
Further Details:      
 
Domain Number 2 Region: 39-60
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000377
Family N-terminal domain of adrenodoxin reductase-like 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSP00000463934
Domain Number - Region: 5-70
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000202
Family FAD/NAD-linked reductases, N-terminal and central domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463934   Gene: ENSG00000161513   Transcript: ENST00000581219
Sequence length 178
Comment pep:novel chromosome:GRCh38:17:74866209:74872977:-1 gene:ENSG00000161513 transcript:ENST00000581219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKR
VEALCSQPRVLNSPALSGEGEDLGASQPLSLGPTSCHPVPQQHPQAHVDIYEKQPVPFGL
VRFGVAPDHPEVKTAHSGRCAFWGNVEVGRDVTVPELQEAYHAVVLSYGAEDHRALEI
Download sequence
Identical sequences J3QQW7
ENSP00000463934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]