SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000463940 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463940
Domain Number 1 Region: 40-334
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.06e-52
Family N-terminal domain of adrenodoxin reductase-like 0.00000534
Further Details:      
 
Domain Number 2 Region: 304-462
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000002
Family N-terminal domain of adrenodoxin reductase-like 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463940   Gene: ENSG00000161513   Transcript: ENST00000583917
Sequence length 463
Comment pep:novel chromosome:GRCh38:17:74862518:74873015:-1 gene:ENSG00000161513 transcript:ENST00000583917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKQ
HPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTV
PELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTA
VILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIK
VPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRL
AVTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVM
DVPGLYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSR
GVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLGH
Download sequence
Identical sequences J3QQX3
ENSP00000463940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]