SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000464595 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464595
Domain Number 1 Region: 5-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000209
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464595   Gene: ENSG00000154040   Transcript: ENST00000579956
Sequence length 73
Comment pep:known chromosome:GRCh38:18:24139062:24152726:1 gene:ENSG00000154040 transcript:ENST00000579956 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVK
QFHQIKDGATNVC
Download sequence
Identical sequences A0A2J8XG94 J3KRI0
ENSP00000462009 ENSP00000462474 ENSP00000464595 ENSP00000462009 ENSP00000462474 ENSP00000464595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]