SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000464780 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464780
Domain Number 1 Region: 40-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000461
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464780   Gene: ENSG00000134779   Transcript: ENST00000590842
Sequence length 304
Comment pep:novel chromosome:GRCh38:18:36786573:36828842:-1 gene:ENSG00000134779 transcript:ENST00000590842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEASSPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDEHIIPLGSMAINSISKLTQLTQSSMYSLPNAPTLAD
LEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKITYNIKMNRRKCVHWKLAVEP
LQWELRSCVSAGMGTGHKQRVSSMKPRSCSVCSRRQSNSMGTTVSQSFLSYGKNVLFFTV
RCCF
Download sequence
Identical sequences ENSP00000465987 ENSP00000464780 NP_001258880.1.87134 NP_001258880.1.92137 XP_008953908.1.60992 ENSP00000464780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]