SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000464817 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000464817
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily Globin-like 1.99e-25
Family Globins 0.00000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000464817   Gene: ENSG00000161544   Transcript: ENST00000590175
Sequence length 125
Comment pep:putative chromosome:GRCh38:17:76528368:76532065:-1 gene:ENSG00000161544 transcript:ENST00000590175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFK
ILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATL
PSSGP
Download sequence
Identical sequences A0A2J8K7C9 K7EIM9
ENSP00000464817 ENSP00000468559 ENSP00000464817 ENSP00000468559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]