SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465244 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465244
Domain Number 1 Region: 13-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465244   Gene: ENSG00000168675   Transcript: ENST00000587905
Sequence length 69
Comment pep:known chromosome:GRCh38:18:13218026:13621143:1 gene:ENSG00000168675 transcript:ENST00000587905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFN
SELEFAQII
Download sequence
Identical sequences A0A2J8K018 A0A2J8RSS5 K7EJM9
ENSP00000465244 ENSP00000465244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]