SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465406 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465406
Domain Number 1 Region: 24-102
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000335
Family Carboxylesterase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465406   Gene: ENSG00000183077   Transcript: ENST00000588199
Sequence length 111
Comment pep:known chromosome:GRCh38:17:78187362:78207187:1 gene:ENSG00000183077 transcript:ENST00000588199 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATR
KSLLHVPYGDGEGEKVDIYFPDESSEALPFFLFFHGGYWQSGRLFPGEWGL
Download sequence
Identical sequences A0A2J8K7Z6 K7EK09
ENSP00000465406 ENSP00000465406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]