SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465477 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465477
Domain Number 1 Region: 89-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.02e-103
Family RecA protein-like (ATPase-domain) 0.000000000122
Further Details:      
 
Domain Number 2 Region: 374-501
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 5.49e-46
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.000000368
Further Details:      
 
Domain Number 3 Region: 3-87
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 1.31e-27
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465477   Gene: ENSG00000152234   Transcript: ENST00000593152
Sequence length 503
Comment pep:known chromosome:GRCh38:18:46084144:46098353:-1 gene:ENSG00000152234 transcript:ENST00000593152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLE
PDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRR
RVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQK
RFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP
YSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLE
RAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINV
GLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTEL
LKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADG
KISEQSDAKLKEIVTNFLAGFEA
Download sequence
Identical sequences G2HGB4
ENSP00000465477 NP_001001935.1.87134 NP_001001935.1.92137 NP_001244264.1.87134 NP_001244264.1.92137 XP_009432169.1.37143 ENSP00000465477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]