SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465551 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465551
Domain Number 1 Region: 40-199
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000366
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465551   Gene: ENSG00000134779   Transcript: ENST00000587129
Sequence length 248
Comment pep:novel chromosome:GRCh38:18:36782985:36828804:-1 gene:ENSG00000134779 transcript:ENST00000587129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEASSPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDEHIIPLGSMAINSISKLTQLTQSSMYSLPNAPTLAD
LEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRAL
YWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKALLGLFDGSSPPVDLNNPRGR
TGIRSRRF
Download sequence
Identical sequences K7EKC0
ENSP00000465551 XP_016881189.1.92137 ENSP00000465551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]