SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465639 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465639
Domain Number 1 Region: 4-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.05e-25
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465639   Gene: ENSG00000018869   Transcript: ENST00000589895
Sequence length 78
Comment pep:known chromosome:GRCh38:19:56389998:56393430:-1 gene:ENSG00000018869 transcript:ENST00000589895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGSELFRDVAIVFSQEEWQWLAPAQRDLYRDVMLETYSNLVSLGLAVSKPDVISFLEQ
GKEPWMVERVVSGGLCPG
Download sequence
Identical sequences A0A2J8JLH8 A0A2J8R5C3 K7EKI7
ENSP00000465639 ENSP00000465639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]