SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465821 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465821
Domain Number 1 Region: 68-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000497
Family LDL receptor-like module 0.0048
Further Details:      
 
Domain Number 2 Region: 31-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465821   Gene: ENSG00000130175   Transcript: ENST00000587509
Sequence length 140
Comment pep:known chromosome:GRCh38:19:11435627:11441311:1 gene:ENSG00000130175 transcript:ENST00000587509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPLLLLLPMCWAVEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYIPSNRVNDGVCDCCDGTDEYNSGVICENTCKEKG
RKERESLQQMAEVTREGFRL
Download sequence
Identical sequences A0A2J8LVS6 A0A2J8S0H6 K7EKX1
ENSP00000465821 ENSP00000465821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]