SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000465940 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465940
Domain Number 1 Region: 2-193
Classification Level Classification E-value
Superfamily Sec7 domain 2.88e-81
Family Sec7 domain 0.00000000465
Further Details:      
 
Domain Number 2 Region: 202-317
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-35
Family Pleckstrin-homology domain (PH domain) 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465940   Gene: ENSG00000108669   Transcript: ENST00000585509
Sequence length 339
Comment pep:putative chromosome:GRCh38:17:78674048:78717025:-1 gene:ENSG00000108669 transcript:ENST00000585509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGER
DEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGV
FQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESI
KNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDK
EPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISA
PTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Download sequence
Identical sequences A0A2J8K7X8 A0A2J8Y1Z6
NP_001278947.1.87134 NP_001278947.1.92137 NP_001278948.1.87134 NP_001278948.1.92137 XP_005585194.1.63531 XP_005624101.1.84170 XP_008692042.1.72690 XP_011523779.1.92137 XP_011718367.1.29376 XP_011718368.1.29376 XP_011718369.1.29376 XP_011897640.1.92194 XP_012611729.1.48125 XP_014197731.1.60992 XP_014975837.1.72884 XP_015294398.1.63531 XP_016788519.1.37143 XP_016788520.1.37143 XP_018883560.1.27298 XP_018883561.1.27298 XP_019654347.1.58354 ENSP00000465940 ENSP00000466512 ENSP00000465940 ENSP00000466512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]