SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466191 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466191
Domain Number 1 Region: 43-145
Classification Level Classification E-value
Superfamily SIS domain 1.37e-25
Family Phosphoglucose isomerase, PGI 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466191   Gene: ENSG00000105220   Transcript: ENST00000592277
Sequence length 146
Comment pep:known chromosome:GRCh38:19:34359734:34368621:1 gene:ENSG00000105220 transcript:ENST00000592277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALCSLQHLGSSDPRALPTLPTATSGQRPAKRRRKSPAMAALTRDPQFQKLQQWYREHR
SELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAAR
ERMFNGEKINYTEGRAVLHVALRNRS
Download sequence
Identical sequences K7ELR7
ENSP00000466191 ENSP00000466191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]