SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466216 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466216
Domain Number 1 Region: 4-71
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.14e-27
Family Canonical RBD 0.0000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466216   Gene: ENSG00000099622   Transcript: ENST00000591055
Sequence length 135
Comment pep:known chromosome:GRCh38:19:1269348:1272803:1 gene:ENSG00000099622 transcript:ENST00000591055 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDA
KDAMMAMNGKVRIRVLSRSPVSRMGHPPANPSRPLSPVCRWTADPSRPGRRRGPRLWGEP
VRVQEWGLRRLQRLL
Download sequence
Identical sequences K7ELT6
ENSP00000466216 ENSP00000467307 ENSP00000466216 ENSP00000467307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]