SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466476 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466476
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-19
Family Protein kinases, catalytic subunit 0.00044
Further Details:      
 
Domain Number 2 Region: 165-261
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.000000000275
Family Regulator of chromosome condensation RCC1 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466476   Gene: ENSG00000160602   Transcript: ENST00000592510
Sequence length 261
Comment pep:novel chromosome:GRCh38:17:28735278:28738245:1 gene:ENSG00000160602 transcript:ENST00000592510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQL
VLSLLSLEPAQRPPLSHIMAQPLCIRALLNLHTDVGSVRMRRPVQGQRAVLGGRVWAPSG
STGGPHLSCRAEKSVAPSNTGSRTTSVRCRGIPRGPVRPAIPPPLSSVYAWGGGLGTPLR
LPMLNTEVVQVAAGRTQKAGVTRSGRLILWEAPPLGAGGGSLLPGAVEQPQPQFISRFLE
GQSGVTIKHVACGDFFTACLT
Download sequence
Identical sequences K7EMF0
ENSP00000466476 ENSP00000466476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]