SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466494 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466494
Domain Number 1 Region: 237-298
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 4.18e-24
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00028
Further Details:      
 
Domain Number 2 Region: 147-220
Classification Level Classification E-value
Superfamily SNARE-like 1.6e-22
Family Clathrin coat assembly domain 0.0003
Further Details:      
 
Domain Number 3 Region: 4-70
Classification Level Classification E-value
Superfamily SNARE-like 0.000000000389
Family Clathrin coat assembly domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466494   Gene: ENSG00000129354   Transcript: ENST00000591676
Sequence length 299
Comment pep:novel chromosome:GRCh38:19:10581282:10587295:-1 gene:ENSG00000129354 transcript:ENST00000591676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWI
KHSNLYCIHPTWCPWRWVWGLSAMVAAQAKRGWAEDRSCTAHLCGLGWGAGAGRDEGGGK
GQGGGSGSVFHLLLHKWHLFLNLAAPVVATTSKNANASLVYSFLYKTIEVFCEYFKELEE
ESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWR
SEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVL
Download sequence
Identical sequences K7EMG5
ENSP00000466494 ENSP00000466494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]