SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466722 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466722
Domain Number 1 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.88e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466722   Gene: ENSG00000108946   Transcript: ENST00000585608
Sequence length 131
Comment pep:known chromosome:GRCh38:17:68512426:68525912:1 gene:ENSG00000108946 transcript:ENST00000585608 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKFFSR
LYQKITRQWPL
Download sequence
Identical sequences A0A2J8KKN7 K7EMZ6
ENSP00000466722 ENSP00000466722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]