SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000466949 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466949
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily Sec7 domain 3.27e-28
Family Sec7 domain 0.00000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466949   Gene: ENSG00000108669   Transcript: ENST00000590300
Sequence length 86
Comment pep:putative chromosome:GRCh38:17:78701672:78724046:-1 gene:ENSG00000108669 transcript:ENST00000590300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGER
DEFNIQVLHAFVELHEFTDLNLVQAL
Download sequence
Identical sequences A0A2J8K7Y0 K7ENH6
ENSP00000466949 ENSP00000466949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]