SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467006 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467006
Domain Number 1 Region: 85-172
Classification Level Classification E-value
Superfamily SH2 domain 3.32e-20
Family SH2 domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 26-107
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000249
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467006   Gene: ENSG00000007264   Transcript: ENST00000590028
Sequence length 174
Comment pep:known chromosome:GRCh38:19:3783872:3786073:-1 gene:ENSG00000007264 transcript:ENST00000590028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHT
RPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLM
PWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHR
Download sequence
Identical sequences K7ENL8
ENSP00000467006 ENSP00000467006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]