SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467091 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000467091
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0123
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467091   Gene: ENSG00000109118   Transcript: ENST00000582853
Sequence length 92
Comment pep:putative chromosome:GRCh38:17:28924078:28949857:-1 gene:ENSG00000109118 transcript:ENST00000582853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPGEWMCHRCTVRRKKREQKKELGHVNGLVDKSGKRTTSPSSDTDLLDRSASKTELKA
IAHARILERRASRPGTPTSSASTETPTSEQND
Download sequence
Identical sequences K7ENU0
ENSP00000467091 ENSP00000467091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]