SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467217 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467217
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-38
Family G proteins 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467217   Gene: ENSG00000152214   Transcript: ENST00000589109
Sequence length 153
Comment pep:known chromosome:GRCh38:18:42743227:43115691:-1 gene:ENSG00000152214 transcript:ENST00000589109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQ
VRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQV
RHTYEIPLVLVGNKIDLEQFRQPTLKEFGREEF
Download sequence
Identical sequences A0A2I2YLC2 A0A2I3H2G3 H2QEG5
ENSPTRP00000016974 NP_001259006.1.87134 NP_001259006.1.92137 XP_003267612.1.23891 XP_003830259.1.60992 XP_018869298.1.27298 ENSNLEP00000013054 ENSNLEP00000013054 ENSP00000282028 ENSP00000467217 ENSP00000467217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]