SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467269 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467269
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Integrin domains 5.02e-27
Family Integrin domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467269   Gene: ENSG00000005961   Transcript: ENST00000587295
Sequence length 104
Comment pep:novel chromosome:GRCh38:17:44372181:44376184:-1 gene:ENSG00000005961 transcript:ENST00000587295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSD
LLYILDIQPQGGLQCFPQPPVNPLKVGFFKRNRPPLEEDDEEGE
Download sequence
Identical sequences K7EP83
ENSP00000467269 ENSP00000467269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]