SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467392 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467392
Domain Number 1 Region: 40-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000275
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467392   Gene: ENSG00000134779   Transcript: ENST00000593035
Sequence length 265
Comment pep:novel chromosome:GRCh38:18:36796072:36828963:-1 gene:ENSG00000134779 transcript:ENST00000593035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEASSPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDDLEDDTHEASDDQPEKPHFDSRSVIFELDSCNGSGK
VCLVYKSGKPALAEDTEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGIS
PQAKQWFSMYKPITYNTNLLTEETDSFVNKLDPSKVFKSKNKIVIPKKKGPVQPAGGQKG
PSGPSGPSTSSTSKSSSGSGNPTRK
Download sequence
Identical sequences A0A2J8MMF6
ENSP00000467392 NP_001258878.1.87134 NP_001258878.1.92137 ENSP00000467392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]