SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467468 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467468
Domain Number 1 Region: 9-72
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000000000209
Family Rhomboid-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467468   Gene: ENSG00000129667   Transcript: ENST00000591860
Sequence length 86
Comment pep:putative chromosome:GRCh38:17:76471814:76473075:-1 gene:ENSG00000129667 transcript:ENST00000591860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPFLNPEVPDQFYRLWLSLFLHAGVVHCLVSVVFQMTILRDLEKLAGWHRIAIIFILSGI
TGNLASAIFLPYRAEPQGSPCLPGRS
Download sequence
Identical sequences A0A2J8K7C0 K7EPN8
ENSP00000467468 ENSP00000467468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]