SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467473 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467473
Domain Number 1 Region: 3-91
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000774
Family Laminin G-like module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467473   Gene: ENSG00000053747   Transcript: ENST00000588164
Sequence length 94
Comment pep:putative chromosome:GRCh38:18:23928625:23931691:1 gene:ENSG00000053747 transcript:ENST00000588164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSGILLDHQTWTRNLQVTLEDGYI
ELSTSDSGGPIFKSPQTYMDGLLHYVSVISDNSG
Download sequence
Identical sequences K7EPP3
ENSP00000467473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]