SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467690 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467690
Domain Number 1 Region: 42-117
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.00000000288
Family Supernatant protein factor (SPF), C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467690   Gene: ENSG00000099203   Transcript: ENST00000589638
Sequence length 191
Comment pep:novel chromosome:GRCh38:19:10833051:10836195:-1 gene:ENSG00000099203 transcript:ENST00000589638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEY
QVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTTISEKLVFFELIFDSLQDDEEVEGWA
EAVEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSA
VNVAVLLLVAV
Download sequence
Identical sequences A0A2J8LW95 K7EQ63
ENSP00000467690 ENSP00000467690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]