SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467792 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467792
Domain Number 1 Region: 27-116
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.49e-16
Family G proteins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467792   Gene: ENSG00000184640   Transcript: ENST00000586128
Sequence length 116
Comment pep:putative chromosome:GRCh38:17:77450576:77488297:1 gene:ENSG00000184640 transcript:ENST00000586128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGK
STLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFG
Download sequence
Identical sequences A0A2J8K7N5
ENSP00000467792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]