SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467794 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467794
Domain Number 1 Region: 10-80
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000000000144
Family Rhomboid-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467794   Gene: ENSG00000072849   Transcript: ENST00000576551
Sequence length 82
Comment pep:known chromosome:GRCh38:17:5477897:5486159:-1 gene:ENSG00000072849 transcript:ENST00000576551 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITN
FLFFGPVGFNFLFNMIFLSRTG
Download sequence
Identical sequences K7EQE8
ENSP00000467794 ENSP00000467794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]