SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000467977 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000467977
Domain Number 1 Region: 30-113
Classification Level Classification E-value
Superfamily Integrin domains 1.67e-17
Family Integrin domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000467977   Gene: ENSG00000083457   Transcript: ENST00000574026
Sequence length 139
Comment pep:putative chromosome:GRCh38:17:3728014:3743540:-1 gene:ENSG00000083457 transcript:ENST00000574026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVSQQELVVGLTKELTLNINL
TNSGEDSYMTSMALNYPRNLQLKRMQKAHVSVVWQLEENAFPNRTADITVTVTKPSIMYV
NTGQGLSHHKEFLFHVHGE
Download sequence
Identical sequences K7EQU0
ENSP00000467977 ENSP00000467977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]