SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468017 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468017
Domain Number 1 Region: 41-95
Classification Level Classification E-value
Superfamily SAP domain 1.4e-19
Family SAP domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468017   Gene: ENSG00000078043   Transcript: ENST00000587810
Sequence length 95
Comment pep:putative chromosome:GRCh38:18:46890894:46920148:-1 gene:ENSG00000078043 transcript:ENST00000587810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSKFHMAVPFYIPTSNVWSDPVSQHPRQHLVLSVFFILAILNMVSSFRVSELQVLLGFA
GRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELY
Download sequence
Identical sequences K7EQX5
ENSP00000468017 ENSP00000468017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]