SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468294 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468294
Domain Number 1 Region: 42-96
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.000000327
Family Supernatant protein factor (SPF), C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468294   Gene: ENSG00000099203   Transcript: ENST00000591695
Sequence length 185
Comment pep:putative chromosome:GRCh38:19:10832813:10836318:-1 gene:ENSG00000099203 transcript:ENST00000591695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEY
QVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTSPLRPCGPGWSAASRCSRYCGPSRHV
TATCKRATWSGSTSGQLSTWRCCCWWLCCRSARSSASSRTSARCPRSPCHGRKNGTKEGQ
QGVCI
Download sequence
Identical sequences A0A2I3RIB9 G3S7Q0 K7ERK5
ENSP00000468294 ENSP00000468294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]