SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468367 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468367
Domain Number 1 Region: 21-157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.49e-43
Family G proteins 0.000000544
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468367   Gene: ENSG00000267261   Transcript: ENST00000592574
Sequence length 282
Comment pep:putative chromosome:GRCh38:17:42119674:42154916:-1 gene:ENSG00000267261 transcript:ENST00000592574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQANETCKCNGWKNPKPPTAPRMDLQQPAANLSEL
CRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLR
KCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAP
Download sequence
Identical sequences A0A1D5Q6J9 A0A2J8KFY1 A0A2J8RF80 K7ERQ8
ENSP00000468367 ENSP00000468367 ENSP00000468367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]