SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468433 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468433
Domain Number 1 Region: 70-193
Classification Level Classification E-value
Superfamily Sec7 domain 2.49e-49
Family Sec7 domain 0.000000223
Further Details:      
 
Weak hits

Sequence:  ENSP00000468433
Domain Number - Region: 26-65
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0209
Family Rad50 coiled-coil Zn hook 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468433   Gene: ENSG00000108669   Transcript: ENST00000586043
Sequence length 194
Comment pep:putative chromosome:GRCh38:17:78700331:78727965:-1 gene:ENSG00000108669 transcript:ENST00000586043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSPGGLGRPCLLQPCPAVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIE
NLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNK
TAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFA
QRYCQCNNGVFQST
Download sequence
Identical sequences K7ERV8
ENSP00000468433 ENSP00000468433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]