SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468492 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468492
Domain Number 1 Region: 42-79
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.0000471
Family Supernatant protein factor (SPF), C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468492   Gene: ENSG00000099203   Transcript: ENST00000591157
Sequence length 95
Comment pep:known chromosome:GRCh38:19:10832985:10836249:-1 gene:ENSG00000099203 transcript:ENST00000591157 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEY
QVIGGAGLDVDFTLESPQGVLLGGANGGRGLQAVL
Download sequence
Identical sequences A0A2J8LW64 K7ES06
ENSP00000468492 ENSP00000468492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]