SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468629 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468629
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000641
Family TBP-associated factors, TAFs 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468629   Gene: ENSG00000175279   Transcript: ENST00000477755
Sequence length 76
Comment pep:putative chromosome:GRCh38:1:10430783:10442334:1 gene:ENSG00000175279 transcript:ENST00000477755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDK
SEEIAQINLERKAQKK
Download sequence
Identical sequences ENSP00000468629 ENSP00000468629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]