SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468690 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468690
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily SIS domain 9.85e-23
Family Phosphoglucose isomerase, PGI 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468690   Gene: ENSG00000266953   Transcript: ENST00000592740
Sequence length 209
Comment pep:putative chromosome:GRCh38:19:34396315:34409364:1 gene:ENSG00000266953 transcript:ENST00000592740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRK
GLHHKDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGAR
SWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDAS
SAKDVDWTARLQDLRLQDAVLGAAHPVPP
Download sequence
Identical sequences K7ESF4
ENSP00000468690 ENSP00000468690 ENSP00000468690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]