SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000468932 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000468932
Domain Number 1 Region: 6-34
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0000000157
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000468932   Gene: ENSG00000130517   Transcript: ENST00000600283
Sequence length 89
Comment pep:known chromosome:GRCh38:19:18340614:18364218:1 gene:ENSG00000130517 transcript:ENST00000600283 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEQPRKAVVVTGFGPFGEHTVNASWIAVQRWDLTILPWLVLNFRAQMILPPRPPKEAGII
GVSHRALPSGARKARPWRQRGPACVRDSG
Download sequence
Identical sequences M0QX66
ENSP00000468932 ENSP00000470622 ENSP00000468932 ENSP00000470622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]