SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000469656 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469656
Domain Number 1 Region: 5-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.11e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469656   Gene: ENSG00000170954   Transcript: ENST00000597748
Sequence length 73
Comment pep:putative chromosome:GRCh38:19:53107898:53123649:-1 gene:ENSG00000170954 transcript:ENST00000597748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFTQLTFRDVAIEFSQDEWKCLNSTQRTLYRDVMLENYRNLVSLGWSAMVQSRLTATFA
SRIQMILLPQPPE
Download sequence
Identical sequences M0QX59
ENSP00000468917 ENSP00000469656 ENSP00000468917 ENSP00000469656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]