SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000469713 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469713
Domain Number 1 Region: 11-130
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000147
Family WD40-repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469713   Gene: ENSG00000160410   Transcript: ENST00000600320
Sequence length 250
Comment pep:novel chromosome:GRCh38:19:40583649:40591368:1 gene:ENSG00000160410 transcript:ENST00000600320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XELYRDPAEDGVTALSVYLTPKTSDSGNWIEIAYGTSSGGVRVIVQHPETVGSGPQLFQT
FTVHRSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILALESA
DGHGGCSAGNDIAGGLTEQELMEQLEHCELAPPAPSAPSWGCLPSPSPRISLTSLHSASS
NTSLSGHRGSPSPPQAEARRRGGGSFVERCQELVRSGPDLRRPPTPAPWPSSGLGTPLTP
PKMKLNETSF
Download sequence
Identical sequences M0QYB1
ENSP00000469713 ENSP00000469713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]