SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000469901 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469901
Domain Number 1 Region: 236-273
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000024
Family Reprolysin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469901   Gene: ENSG00000142303   Transcript: ENST00000593913
Sequence length 289
Comment pep:known chromosome:GRCh38:19:8580688:8605779:-1 gene:ENSG00000142303 transcript:ENST00000593913 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEIAFPTRVDHNGALLAFSPPP
PRRQRRGTGATAESRLFYKVASPSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARP
HCLYAGHLQGQASSSHVAISTCGGLHGLIVADEEEYLIEPLHGGPKGSRSPEESGPHVVY
KRSSLRHPHLDTACGVRDEKPWKGRPWWLRTLKPPPARPLGNETERGQPGLKRSVSRERY
VETLVVADKMMVAYHGRRDVEQYVLAIMNIVRLPNFSRTRVWEAPLTSS
Download sequence
Identical sequences M0QY36
ENSP00000469559 ENSP00000469901 ENSP00000466996 ENSP00000468382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]