SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000470069 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470069
Domain Number 1 Region: 43-280
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.47e-84
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.00000000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470069   Gene: ENSG00000126456   Transcript: ENST00000599144
Sequence length 281
Comment pep:putative chromosome:GRCh38:19:49659579:49665731:-1 gene:ENSG00000126456 transcript:ENST00000599144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEV
TAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLS
CLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFI
VDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASS
LENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES
Download sequence
Identical sequences M0QYT9
ENSP00000366339 ENSP00000470069 ENSP00000472582 ENSP00000472601 gi|308199452|ref|NP_001184055.1| gi|308199454|ref|NP_001184054.1| ENSP00000470069 ENSP00000472582 ENSP00000472601 NP_001184054.1.87134 NP_001184054.1.92137 NP_001184055.1.87134 NP_001184055.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]