SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000470245 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470245
Domain Number 1 Region: 33-193
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2e-56
Family Eukaryotic proteases 0.0000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470245   Gene: ENSG00000167759   Transcript: ENST00000595547
Sequence length 204
Comment pep:novel chromosome:GRCh38:19:51056587:51065067:-1 gene:ENSG00000167759 transcript:ENST00000595547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLL
CGGVLVHPKWVLTAAHCLKEGLKVYLGKHALGRVEAVNYPKTLQCANIQLRSDEECRQVY
PGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSR
YVLWIRETIRKYETQQQKWLKGPQ
Download sequence
Identical sequences Q86VI7
ENSP00000470245 ENSP00000470245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]