SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000470383 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470383
Domain Number 1 Region: 42-97
Classification Level Classification E-value
Superfamily Sec7 domain 0.0000000000000733
Family Sec7 domain 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470383   Gene: ENSG00000268465   Transcript: ENST00000595676
Sequence length 97
Comment pep:putative chromosome:GRCh38:19:48465837:48472431:1 gene:ENSG00000268465 transcript:ENST00000595676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDP
KKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGD
Download sequence
Identical sequences A0A2J8U7K1 M0QZ92
ENSP00000470383 ENSP00000470383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]