SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000470566 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000470566
Domain Number - Region: 5-59
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000101
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470566   Gene: ENSG00000160013   Transcript: ENST00000597185
Sequence length 115
Comment pep:putative chromosome:GRCh38:19:46621167:46625072:-1 gene:ENSG00000160013 transcript:ENST00000597185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDLLAFRFYAFNPILDPWVFILFRKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRR
DPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC
Download sequence
Identical sequences M0QZI2
ENSP00000470566 ENSP00000470566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]