SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000470790 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470790
Domain Number 1 Region: 17-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 2 Region: 206-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000114
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470790   Gene: ENSG00000258405   Transcript: ENST00000601120
Sequence length 253
Comment pep:known chromosome:GRCh38:19:52492830:52511142:1 gene:ENSG00000258405 transcript:ENST00000601120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHEEAAQKRKGKEPGMALPQGRLTFRDVAIEFSLAEWKFLNPAQRALYREVMLENYRNL
EAVDISSKRMMKEVLSTGQGNTEVIHTGMLQRHESYHTGDFCFQEIEKDIHDFEFQSQKD
ERNGHEASMPKIKELMGSTDRHDQRHAGNKPIKDQLGLSFHLHLPELHIFQPEEKIANQV
EKSVNDASSISTSQRISCRPETHTPNNYGNNFFHSSLLTQKQEVHMREKSFQCNETGEAF
NCSSFVRKHQIIH
Download sequence
Identical sequences M0QZV4
ENSP00000470790 ENSP00000470790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]