SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000470792 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470792
Domain Number 1 Region: 12-177
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.1e-51
Family BAR domain 0.000000448
Further Details:      
 
Domain Number 2 Region: 237-301
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-23
Family SH3-domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470792   Gene: ENSG00000141985   Transcript: ENST00000598564
Sequence length 304
Comment pep:known chromosome:GRCh38:19:4360371:4400418:-1 gene:ENSG00000141985 transcript:ENST00000598564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQP
NPASRAKLTMLNTVSKIRGQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELR
QALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRM
REASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMP
PLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLV
PLPQ
Download sequence
Identical sequences NP_001186873.1.87134 NP_001186873.1.92137 gi|317108193|ref|NP_001186873.1| ENSP00000470792 ENSP00000470792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]