SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471007 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471007
Domain Number 1 Region: 22-99
Classification Level Classification E-value
Superfamily EF-hand 0.0000000117
Family Penta-EF-hand proteins 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471007   Gene: ENSG00000182472   Transcript: ENST00000595177
Sequence length 104
Comment pep:novel chromosome:GRCh38:19:38730678:38735422:-1 gene:ENSG00000182472 transcript:ENST00000595177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLPLELGLEQLFQELAGEEEELNASQLQALLSIALEPGFHLNNQLTQTLTSRYRDSRLRV
DFERFVSCVAHLTCIFCHCSQHLDGGEGVICLTHRQWMEVATFS
Download sequence
Identical sequences M0R052
ENSP00000471007 ENSP00000471007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]