SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471060 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471060
Domain Number 1 Region: 44-97
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.0000000562
Family Supernatant protein factor (SPF), C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471060   Gene: ENSG00000117500   Transcript: ENST00000370290
Sequence length 120
Comment pep:known chromosome:GRCh38:1:93151858:93180516:-1 gene:ENSG00000117500 transcript:ENST00000370290 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEI
EYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTCIRSKNGPGTAVHAYNPSTFRGQV
Download sequence
Identical sequences M0R072
ENSP00000471060 ENSP00000471060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]