SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471130 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000471130
Domain Number - Region: 2-37
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0235
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471130   Gene: ENSG00000130517   Transcript: ENST00000595552
Sequence length 87
Comment pep:putative chromosome:GRCh38:19:18357506:18369948:1 gene:ENSG00000130517 transcript:ENST00000595552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGSLGSQKSKVKVVAGLVPSGGAEGK
NPSLPKVTVFSAAEGGPGPSRLSVASP
Download sequence
Identical sequences M0R0B6
ENSP00000471130 ENSP00000471130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]